PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082263.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 381aa    MW: 42211.8 Da    PI: 6.8864
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082263.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.91.2e-171763349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    ie++   + tfskRr g+ KKA+ELS+LC+++v +iifs+t++ y +
  XP_011082263.1 17 IESQDDLYATFSKRRLGLYKKASELSTLCGIDVGIIIFSPTDNPYSF 63
                    888999999*******************************9987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.7E-22766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.801767IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.03E-23881IPR002100Transcription factor, MADS-box
CDDcd002652.96E-29879No hitNo description
PRINTSPR004041.9E-12929IPR002100Transcription factor, MADS-box
PfamPF003191.6E-201763IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-122944IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-124465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MAGRQTRGRQ RIPMRLIESQ DDLYATFSKR RLGLYKKASE LSTLCGIDVG IIIFSPTDNP  60
YSFFHPSMES VIERYRNPNQ PPSNLARIVE GHTRTRIVQL NKRLDEVQDM KELIKEQEKY  120
LDEVDKTRPQ GWWEQIPVES LNAQQVQEWK AWFGNLHARV TSRIEELTNG GSGPLENAPI  180
FPDPPGASTT IFPSIYAQNY VPPAGTSCAP GGGIIGSDQF SGQYYYAHPQ GHDSFASGPS  240
QFFAPPHGQY PSGFSTSQYY SIPGALNPSG IGPSQYYGFP PSQHSSGVGP SQYYGPQPTQ  300
DPSDFGPTQF YGLLSSQDPL GIRPSQFYMP PSNQIPSGVG LNQFYGSPPS QDQSGAGPNQ  360
FYRPPLGQDP SSARLRRFYN P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082263.10.0PREDICTED: MADS-box transcription factor 17-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-31AGAMOUS-like 61